PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00045.1.g02860.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 524aa    MW: 56327.3 Da    PI: 8.5508
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00045.1.g02860.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.18.7e-22183231149
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka++v+  g+++rfCqqCsr+
  Zjn_sc00045.1.g02860.1.am.mk 183 RCQAEGCKADLSAAKHYHRRHKVCEYHAKAAAVADGGKQKRFCQQCSRY 231
                                   6***********************************************8 PP

2SBP44.25e-142602894877
                                   SEEETTT--SS--S-STTTT-------S-- CS
                           SBP  48 rfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                    fh l efDe+krsCr+rL +hn+rrrk++
  Zjn_sc00045.1.g02860.1.am.mk 260 EFHVLAEFDESKRSCRKRLTEHNRRRRKSA 289
                                   6***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-27177275IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.615181288IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-21182233IPR004333Transcription factor, SBP-box
PfamPF031102.1E-16184232IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-10260289IPR004333Transcription factor, SBP-box
PfamPF031103.2E-7260287IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MSPATTDADF AFAPMQPNLG FDVAGNSHQD QHNLYDNFVD FAAGFPFQQD SSMSLLPPQT  60
SRPLLAPPPC LAMTAMPSLS LNHQMPLPGV QNAEMCHPFN GSAGSPFLMK REDGPLVDAG  120
GGGGGGRLGL NLGRLTYFSP ADVLAVDRLL MTRSSRFGVG MGMAGLLGLG LGAAHHHQPP  180
PPRCQAEGCK ADLSAAKHYH RRHKVCEYHA KAAAVADGGK QKRFCQQCSR YVHPRLPRAQ  240
PHTCPTAEIG VTYYGHVTIE FHVLAEFDES KRSCRKRLTE HNRRRRKSAS AQGGEDSSPP  300
PKKADTTSIT TSYNSDQKSA STVAAKSTAI TPNGSGVSCL DMADNNGHQT SSAAAAAAPT  360
ALSLAAPPEK DSGGLDAILM MHGSRVHRDD DEDQRFIPSL LLQAQQQQQH HNDGGHMLSC  420
SSSMPDQHQN GGGGCNGFFE RNRRAAFYVH VQLAHEHVVG CPSICDRWAF NSKDSIRGPG  480
PAKGWRWIAV PARTPAHGDL VTWDWNGRGA KKTLILRTRT FAGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-211842871184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451645.11e-118hypothetical protein SORBIDRAFT_04g005180
SwissprotQ0E3F83e-52SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLC5XW901e-118C5XW90_SORBI; Putative uncharacterized protein Sb04g005180
STRINGSb04g005180.11e-118(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-31squamosa promoter binding protein-like 8